PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G257600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 760aa    MW: 86814.7 Da    PI: 6.4767
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G257600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1101.48.9e-3277164291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fYn+YA++vGFs+r+s  ++s+r+g+i++r+ vCs+eg+r+e +++  +++r+r++tr+gCka+++vkk+++gkw vtkl+++HnHel+p
  Potri.005G257600.1  77 FYNSYARRVGFSTRVSVYQRSRRDGSIICRQIVCSREGFRREGNEN--RSKRQRTVTRVGCKAQMTVKKQSSGKWAVTKLVEDHNHELVP 164
                         9*****************************************9988..999*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.3E-2977164IPR004330FAR1 DNA binding domain
PfamPF105513.2E-28285375IPR018289MULE transposase domain
PROSITE profilePS5096610.633565601IPR007527Zinc finger, SWIM-type
PfamPF044341.6E-10575600IPR007527Zinc finger, SWIM-type
SMARTSM005756.4E-9576603IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MDHLNVIPFD NISMGSEDDP NTALHLQHHQ PHNLDFDFDY PNNNNDDDLL EPTSLSDPNL  60
DPYEGMEFDS EQSARIFYNS YARRVGFSTR VSVYQRSRRD GSIICRQIVC SREGFRREGN  120
ENRSKRQRTV TRVGCKAQMT VKKQSSGKWA VTKLVEDHNH ELVPPDKVHS LRSHRHVSGS  180
ARSLIDTLQA AGMGPSGVMS VLIRESGGIN NVGFTKVDCQ NYMSTSRQRT LGPGGQAVFD  240
YLKQMQAEDP GFFYAVQGDF ENSTGNVFWA DANARMNYSF FGDTITFDTT YRTNRYRVPF  300
APFTGWNHHG QPLLFGCALL LNESESSFVW LFETWLAAMS GRCPISITTD QDRIIRAAVS  360
QAFPGTRLRF CKWNVFREAQ EKLSHEYHSH PTFEPEFHRC INMAESIDEF ESCWESLLQR  420
FDLSDNEWLQ SMYNARQQWV PVYLQDTFFG EMSILQGSDS INSYFDGYIN ASTNIHNLIK  480
QYEKAMAIRH EKEVKADYDT LNSPPVLKTP SPMEKQAANL YTRRIFMKFQ EELVETLAYL  540
ATVVDDIGSA ITYQVAKFGE DHKVHHVRFN AFEKRASCSC QMFEFSGIIC RHILAVFRVK  600
NVLTLPSNYI LKRWTRNAKS GVVLDEHTLG LPCNTQESLA ARSENLRQEA IKYVEEGAES  660
EHIYNVAMDA LHEAIRKVAA AKMCGSAPVQ TTVVNGSQQL LSCSLDEDEK IQELTAELEQ  720
ASQRCEAYRT KLLCVMKDME EWKLRISVKV QNVRLKMKD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041139.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLU5GH910.0U5GH91_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0005s27900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5